THNSL2 Antikörper
-
- Target Alle THNSL2 Antikörper anzeigen
- THNSL2 (threonine Synthase-Like 2 (THNSL2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser THNSL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- THNSL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF
- Top Product
- Discover our top product THNSL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
THNSL2 Blocking Peptide, catalog no. 33R-5274, is also available for use as a blocking control in assays to test for specificity of this THNSL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THNSL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THNSL2 (threonine Synthase-Like 2 (THNSL2))
- Andere Bezeichnung
- THNSL2 (THNSL2 Produkte)
- Synonyme
- BC051244 antikoerper, TSH2 antikoerper, SOFAT antikoerper, THS2 antikoerper, RGD1309144 antikoerper, Tsh2 antikoerper, zgc:123281 antikoerper, threonine synthase-like 2 (bacterial) antikoerper, threonine synthase like 2 antikoerper, threonine synthase-like 2 antikoerper, Thnsl2 antikoerper, THNSL2 antikoerper, thnsl2 antikoerper
- Hintergrund
- THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.
- Molekulargewicht
- 54 kDa (MW of target protein)
-