SAPS1 Antikörper (N-Term)

Produktnummer ABIN632640

Produktdetails anti-SAPS1 Antikörper

Target: SAPS1 (SAPS Domain Family, Member 1 (SAPS1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAPS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PPP6 R1 antibody was raised against the N terminal of PPP6 1

Aufreinigung: Affinity purified

Immunogen: PPP6 R1 antibody was raised using the N terminal of PPP6 1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP6R1 Blocking Peptide, catalog no. 33R-6008, is also available for use as a blocking control in assays to test for specificity of this PPP6R1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAPS1

Target: SAPS1 (SAPS Domain Family, Member 1 (SAPS1))

Andere Bezeichnung: PPP6R1 (SAPS1 Produkte)

Hintergrund: Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit.

Molekulargewicht: 97 kDa (MW of target protein)