PLSCR1 Antikörper (N-Term)

Produktnummer ABIN632641

Produktdetails anti-PLSCR1 Antikörper

Target: PLSCR1 (phospholipid Scramblase 1 (PLSCR1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLSCR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLSCR1 antibody was raised against the N terminal of PLSCR1

Aufreinigung: Affinity purified

Immunogen: PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLSCR1 Blocking Peptide, catalog no. 33R-5843, is also available for use as a blocking control in assays to test for specificity of this PLSCR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLSCR1

Target: PLSCR1 (phospholipid Scramblase 1 (PLSCR1))

Andere Bezeichnung: PLSCR1 (PLSCR1 Produkte)

Synonyme: mmtra1b antikoerper, MGC84969 antikoerper, PLSCR1 antikoerper, MGC148322 antikoerper, MMTRA1B antikoerper, MmTRA1a antikoerper, MmTRA1b antikoerper, Nor1 antikoerper, Tra1 antikoerper, Tra1a antikoerper, Tra1b antikoerper, Tras1 antikoerper, Tras2 antikoerper, PLSCR2 antikoerper, phospholipid scramblase 1 L homeolog antikoerper, phospholipid scramblase 1 antikoerper, plscr1.L antikoerper, PLS1 antikoerper, PVX_111580 antikoerper, PLSCR1 antikoerper, plscr1 antikoerper, Plscr1 antikoerper, LOC100712949 antikoerper, PLSCR2 antikoerper, LOC100341366 antikoerper, LOC611500 antikoerper

Hintergrund: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin