LRRC23 Antikörper (N-Term)

Produktnummer ABIN632645

Produktdetails anti-LRRC23 Antikörper

Target: LRRC23 (Leucine Rich Repeat Containing 23 (LRRC23))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC23 antibody was raised against the N terminal of LRRC23

Aufreinigung: Affinity purified

Immunogen: LRRC23 antibody was raised using the N terminal of LRRC23 corresponding to a region with amino acids LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC23 Blocking Peptide, catalog no. 33R-4931, is also available for use as a blocking control in assays to test for specificity of this LRRC23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC23

Target: LRRC23 (Leucine Rich Repeat Containing 23 (LRRC23))

Andere Bezeichnung: LRRC23 (LRRC23 Produkte)

Synonyme: LRPB7 antikoerper, 4921537K05Rik antikoerper, B7 antikoerper, Lrpb7 antikoerper, leucine rich repeat containing 23 antikoerper, LRRC23 antikoerper, Lrrc23 antikoerper

Hintergrund: LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

Molekulargewicht: 40 kDa (MW of target protein)