FAM160B1 Antikörper (N-Term)
FAM160B1
Reaktivität: Human
WB
Wirt: Kaninchen
Polyclonal
unconjugated
1 image
-
- Target Alle FAM160B1 Antikörper anzeigen
- FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM160B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM160 B1 antibody was raised against the N terminal of FAM160 1
- Aufreinigung
- Affinity purified
- Immunogen
- FAM160 B1 antibody was raised using the N terminal of FAM160 1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH
- Top Product
- Discover our top product FAM160B1 Primärantikörper
-
anti-Family with Sequence Similarity 160, Member B1 (FAM160B1) (AA 35-84) antibody
FAM160B1 Reaktivität: Human, Maus, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Ratte, Zebrafisch (Danio rerio), Fledermaus, Huhn, Affe, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM160B1 Blocking Peptide, catalog no. 33R-3884, is also available for use as a blocking control in assays to test for specificity of this FAM160B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM160 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))
- Andere Bezeichnung
- FAM160B1 (FAM160B1 Produkte)
- Synonyme
- zgc:162264 antikoerper, kiaa1600 antikoerper, KIAA1600 antikoerper, bA106M7.3 antikoerper, AI450540 antikoerper, mKIAA1600 antikoerper, RGD1306116 antikoerper, family with sequence similarity 160, member B1 antikoerper, family with sequence similarity 160 member B1 antikoerper, family with sequence similarity 160 member B1 S homeolog antikoerper, fam160b1 antikoerper, FAM160B1 antikoerper, Fam160b1 antikoerper, fam160b1.S antikoerper
- Hintergrund
- The function of FAM160 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 86 kDa (MW of target protein)
-
Sie sind hier:
