DHFRL1 Antikörper (Middle Region)
-
- Target Alle DHFRL1 Antikörper anzeigen
- DHFRL1 (Dihydrofolate Reductase-Like 1 (DHFRL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHFRL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DHFRL1 antibody was raised against the middle region of DHFRL1
- Aufreinigung
- Affinity purified
- Immunogen
- DHFRL1 antibody was raised using the middle region of DHFRL1 corresponding to a region with amino acids RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
- Top Product
- Discover our top product DHFRL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHFRL1 Blocking Peptide, catalog no. 33R-7973, is also available for use as a blocking control in assays to test for specificity of this DHFRL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHFRL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHFRL1 (Dihydrofolate Reductase-Like 1 (DHFRL1))
- Andere Bezeichnung
- DHFRL1 (DHFRL1 Produkte)
- Synonyme
- DHFRP4 antikoerper, dihydrofolate reductase 2 antikoerper, DHFR2 antikoerper
- Hintergrund
- DHFRL1 may play a role in folate metabolism.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-