DDHD2 Antikörper (N-Term)
-
- Target Alle DDHD2 Antikörper anzeigen
- DDHD2 (DDHD Domain Containing 2 (DDHD2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDHD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DDHD2 antibody was raised against the N terminal of DDHD2
- Aufreinigung
- Affinity purified
- Immunogen
- DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD
- Top Product
- Discover our top product DDHD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDHD2 Blocking Peptide, catalog no. 33R-1971, is also available for use as a blocking control in assays to test for specificity of this DDHD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDHD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDHD2 (DDHD Domain Containing 2 (DDHD2))
- Andere Bezeichnung
- DDHD2 (DDHD2 Produkte)
- Hintergrund
- DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.
- Molekulargewicht
- 81 kDa (MW of target protein)
-