DCMP Deaminase (DCTD) (Middle Region) Antikörper
-
- Target Alle DCMP Deaminase (DCTD) Antikörper anzeigen
- DCMP Deaminase (DCTD)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DCTD antibody was raised against the middle region of DCTD
- Aufreinigung
- Affinity purified
- Immunogen
- DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL
- Top Product
- Discover our top product DCTD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DCTD Blocking Peptide, catalog no. 33R-6407, is also available for use as a blocking control in assays to test for specificity of this DCTD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCMP Deaminase (DCTD)
- Andere Bezeichnung
- DCTD (DCTD Produkte)
- Synonyme
- zgc:110226 antikoerper, DCTD antikoerper, 6030466N05Rik antikoerper, Afu2g06240 antikoerper, MGC81193 antikoerper, dCMP deaminase antikoerper, deoxycytidylate deaminase antikoerper, cell division protein DedD antikoerper, dCMP deaminase L homeolog antikoerper, conserved uncharacterised protein antikoerper, DCTD antikoerper, dctd antikoerper, dctD antikoerper, Dctd antikoerper, AFUA_2G06240 antikoerper, ACLA_068070 antikoerper, LELG_03636 antikoerper, VIBHAR_RS20285 antikoerper, LOC5564022 antikoerper, Ccur_00700 antikoerper, PAAG_00286 antikoerper, SPAP_0719 antikoerper, LOC100285892 antikoerper, dctd.L antikoerper, CNB00950 antikoerper, THAPS_42740 antikoerper, dCMP deaminase antikoerper, Thena_0587 antikoerper, Ccan_15560 antikoerper
- Substanzklasse
- Viral Protein
- Hintergrund
- The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 21 kDa (MW of target protein)
-