CHMP1B Antikörper (N-Term)

Produktnummer ABIN632659

Produktdetails anti-CHMP1B Antikörper

Target: CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHMP1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHMP1 B antibody was raised against the N terminal of CHMP1

Aufreinigung: Affinity purified

Immunogen: CHMP1 B antibody was raised using the N terminal of CHMP1 corresponding to a region with amino acids KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHMP1B Blocking Peptide, catalog no. 33R-4435, is also available for use as a blocking control in assays to test for specificity of this CHMP1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHMP1B

Target: CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))

Andere Bezeichnung: CHMP1B (CHMP1B Produkte)

Synonyme: C10orf2 antikoerper, C18-ORF2 antikoerper, C18orf2 antikoerper, CHMP1.5 antikoerper, Vps46-2 antikoerper, Vps46B antikoerper, hVps46-2 antikoerper, 2810405I11Rik antikoerper, Chmp1b1 antikoerper, Chmp1.5 antikoerper, fb10c03 antikoerper, wu:fb10c03 antikoerper, zgc:56134 antikoerper, chromatin modifying protein 1b antikoerper, hypothetical protein antikoerper, charged multivesicular body protein 1B antikoerper, chromatin modifying protein 1B antikoerper, LOC692931 antikoerper, PGTG_18215 antikoerper, CHMP1B antikoerper, Chmp1b antikoerper, chmp1b antikoerper

Hintergrund: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.

Molekulargewicht: 22 kDa (MW of target protein)