CAMK1G Antikörper (N-Term)
-
- Target Alle CAMK1G Antikörper anzeigen
- CAMK1G (Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CAMK1G Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CAMK1 G antibody was raised against the N terminal of CAMK1
- Aufreinigung
- Affinity purified
- Immunogen
- CAMK1 G antibody was raised using the N terminal of CAMK1 corresponding to a region with amino acids SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE
- Top Product
- Discover our top product CAMK1G Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CAMK1G Blocking Peptide, catalog no. 33R-8410, is also available for use as a blocking control in assays to test for specificity of this CAMK1G antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAMK1G (Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G))
- Andere Bezeichnung
- CAMK1G (CAMK1G Produkte)
- Hintergrund
- This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.
- Molekulargewicht
- 53 kDa (MW of target protein)
-