HOMER1 Antikörper
-
- Target Alle HOMER1 Antikörper anzeigen
- HOMER1 (Homer Homolog 1 (HOMER1))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HOMER1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD
- Top Product
- Discover our top product HOMER1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.0156 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HOMER1 Blocking Peptide, catalog no. 33R-2502, is also available for use as a blocking control in assays to test for specificity of this HOMER1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HOMER1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HOMER1 (Homer Homolog 1 (HOMER1))
- Andere Bezeichnung
- HOMER1 (HOMER1 Produkte)
- Hintergrund
- HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-