UGP2 Antikörper (N-Term)
-
- Target Alle UGP2 Antikörper anzeigen
- UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UGP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UGP2 antibody was raised against the N terminal of µgP2
- Aufreinigung
- Affinity purified
- Immunogen
- UGP2 antibody was raised using the N terminal of µgP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN
- Top Product
- Discover our top product UGP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UGP2 Blocking Peptide, catalog no. 33R-9141, is also available for use as a blocking control in assays to test for specificity of this µgP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))
- Andere Bezeichnung
- UGP2 (UGP2 Produkte)
- Hintergrund
- UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen, in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-