TRUB2 Antikörper (N-Term)

Produktnummer ABIN632678

Produktdetails anti-TRUB2 Antikörper

Target: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRUB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRUB2 antibody was raised against the N terminal of TRUB2

Aufreinigung: Affinity purified

Immunogen: TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRUB2 Blocking Peptide, catalog no. 33R-6072, is also available for use as a blocking control in assays to test for specificity of this TRUB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRUB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRUB2

Target: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Andere Bezeichnung: TRUB2 (TRUB2 Produkte)

Synonyme: CLONE24922 antikoerper, RP11-339B21.1 antikoerper, G430055L02Rik antikoerper, fc51e05 antikoerper, wu:fc51e05 antikoerper, zgc:91836 antikoerper, TruB pseudouridine synthase family member 2 antikoerper, TruB pseudouridine (psi) synthase family member 2 antikoerper, TruB pseudouridine (psi) synthase homolog 2 (E. coli) antikoerper, TruB pseudouridine (psi) synthase family member 2 L homeolog antikoerper, TRUB2 antikoerper, trub2 antikoerper, trub2.L antikoerper, Trub2 antikoerper

Hintergrund: Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.

Molekulargewicht: 37 kDa (MW of target protein)