FAM113A Antikörper (C-Term)

Produktnummer ABIN632680

Produktdetails anti-FAM113A Antikörper

Target: FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM113A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM113 A antibody was raised against the C terminal of FAM113

Aufreinigung: Affinity purified

Immunogen: FAM113 A antibody was raised using the C terminal of FAM113 corresponding to a region with amino acids YPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM113A Blocking Peptide, catalog no. 33R-10201, is also available for use as a blocking control in assays to test for specificity of this FAM113A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM113A

Target: FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))

Andere Bezeichnung: FAM113A (FAM113A Produkte)

Synonyme: C20orf81 antikoerper, FAM113A antikoerper, bA12M19.1 antikoerper, A930025D01Rik antikoerper, AI480484 antikoerper, Fam113a antikoerper, RGD1308836 antikoerper, PC-esterase domain containing 1A antikoerper, PCED1A antikoerper, Pced1a antikoerper

Hintergrund: FAM113A is involved in protein binding and hydrolase activity.

Molekulargewicht: 52 kDa (MW of target protein)