ADSSL1 Antikörper (Middle Region)

Produktnummer ABIN632681

Produktdetails anti-ADSSL1 Antikörper

Target: ADSSL1 (Adenylosuccinate Synthase Like 1 (ADSSL1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADSSL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADSSL1 antibody was raised against the middle region of ADSSL1

Aufreinigung: Affinity purified

Immunogen: ADSSL1 antibody was raised using the middle region of ADSSL1 corresponding to a region with amino acids VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADSSL1 Blocking Peptide, catalog no. 33R-9461, is also available for use as a blocking control in assays to test for specificity of this ADSSL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADSSL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADSSL1

Target: ADSSL1 (Adenylosuccinate Synthase Like 1 (ADSSL1))

Andere Bezeichnung: ADSSL1 (ADSSL1 Produkte)

Synonyme: AdSS 1 antikoerper, zgc:85738 antikoerper, adss1-b antikoerper, adss1 antikoerper, adss1-a antikoerper, adssl1 antikoerper, ADSS1 antikoerper, AI528595 antikoerper, Adss antikoerper, Adss1 antikoerper, adss1a antikoerper, adssl1a antikoerper, adenylosuccinate synthase like 1 antikoerper, adenylosuccinate synthase like 1 S homeolog antikoerper, adenylosuccinate synthase like 1 L homeolog antikoerper, inverted formin-2 antikoerper, adenylosuccinate synthetase like 1 antikoerper, Adenylosuccinate synthetase isozyme 1 antikoerper, ADSSL1 antikoerper, adssl1 antikoerper, adssl1.S antikoerper, adssl1.L antikoerper, LOC100061064 antikoerper, Adssl1 antikoerper, pura1 antikoerper

Hintergrund: ADSSL1 is a muscle isozyme of adenylosuccinate synthase (EC 6.3.4.4), which catalyzes the initial reaction in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP).

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process