LIPJ Antikörper (C-Term)

Produktnummer ABIN632690

Produktdetails anti-LIPJ Antikörper

Target: LIPJ (Lipase, Family Member J (LIPJ))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIPJ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Lipase J antibody was raised against the C terminal of LIPJ

Aufreinigung: Affinity purified

Immunogen: Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lipase J Blocking Peptide, catalog no. 33R-5229, is also available for use as a blocking control in assays to test for specificity of this Lipase J antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPJ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIPJ

Target: LIPJ (Lipase, Family Member J (LIPJ))

Andere Bezeichnung: Lipase J (LIPJ Produkte)

Synonyme: LIPL1 antikoerper, bA425M17.2 antikoerper, lipase family member J antikoerper, LIPJ antikoerper

Hintergrund: LIPJ belongs to the AB hydrolase superfamily, lipase family. The exact function of LIPJ remains unknown.

Molekulargewicht: 42 kDa (MW of target protein)