C4orf33 Antikörper (C-Term)

Produktnummer ABIN632694

Produktdetails anti-C4orf33 Antikörper

Target: C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C4orf33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C4 ORF33 antibody was raised against the C terminal Of C4 rf33

Aufreinigung: Affinity purified

Immunogen: C4 ORF33 antibody was raised using the C terminal Of C4 rf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C4ORF33 Blocking Peptide, catalog no. 33R-7238, is also available for use as a blocking control in assays to test for specificity of this C4ORF33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C4orf33

Target: C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))

Andere Bezeichnung: C4ORF33 (C4orf33 Produkte)

Hintergrund: C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.

Molekulargewicht: 23 kDa (MW of target protein)