C4orf33 Antikörper (C-Term)
-
- Target Alle C4orf33 Produkte
- C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C4orf33 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C4 ORF33 antibody was raised against the C terminal Of C4 rf33
- Aufreinigung
- Affinity purified
- Immunogen
- C4 ORF33 antibody was raised using the C terminal Of C4 rf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C4ORF33 Blocking Peptide, catalog no. 33R-7238, is also available for use as a blocking control in assays to test for specificity of this C4ORF33 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))
- Andere Bezeichnung
- C4ORF33 (C4orf33 Produkte)
- Synonyme
- C4H4orf33 antikoerper, MGC108272 antikoerper, MGC197879 antikoerper, chromosome 4 open reading frame 33 antikoerper, chromosome 4 C4orf33 homolog antikoerper, zgc:77739 antikoerper, C4orf33 antikoerper, C4H4orf33 antikoerper, c4orf33 antikoerper, zgc:77739 antikoerper
- Hintergrund
- C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.
- Molekulargewicht
- 23 kDa (MW of target protein)
-