-
- Target Alle DPH1 Antikörper anzeigen
- DPH1 (DPH1 Homolog (DPH1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DPH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
- Top Product
- Discover our top product DPH1 Primärantikörper
-
anti-DPH1 Homolog (DPH1) (AA 216-324) antibody
DPH1 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 2C5 unconjugated
anti-DPH1 Homolog (DPH1) (AA 192-318) antibodyDPH1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-DPH1 Homolog (DPH1) (AA 35-84) antibodyDPH1 Reaktivität: Human, Maus, Hund, Meerschweinchen, Pferd, Kaninchen, Ratte, Saccharomyces cerevisiae, Zebrafisch (Danio rerio), Affe, Schwein, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-DPH1 Homolog (DPH1) (AA 272-321) antibodyDPH1 Reaktivität: Human, Maus, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Affe, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-DPH1 Homolog (DPH1) (N-Term) antibodyDPH1 Reaktivität: Human, Maus, Hund, Meerschweinchen, Pferd, Kaninchen, Ratte, Rind (Kuh), Saccharomyces cerevisiae, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DPH1 Blocking Peptide, catalog no. 33R-8068, is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPH1 (DPH1 Homolog (DPH1))
- Andere Bezeichnung
- DPH1 (DPH1 Produkte)
- Hintergrund
- Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.
- Molekulargewicht
- 49 kDa (MW of target protein)
-
Sie sind hier:
