DPH1 Antikörper

Produktnummer ABIN632695

Produktdetails anti-DPH1 Antikörper

Target: DPH1 (DPH1 Homolog (DPH1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPH1 Blocking Peptide, catalog no. 33R-8068, is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPH1

Target: DPH1 (DPH1 Homolog (DPH1))

Andere Bezeichnung: DPH1 (DPH1 Produkte)

Synonyme: DPH1 antikoerper, DPH1-OVCA2 antikoerper, dph1-ovca2 antikoerper, dph2l antikoerper, dph2l1 antikoerper, ovca1 antikoerper, DPH2L antikoerper, DPH2L1 antikoerper, OVCA1 antikoerper, zgc:110702 antikoerper, 2310011M22Rik antikoerper, 4930488F09Rik antikoerper, AW551873 antikoerper, Dph2l1 antikoerper, Ovca1 antikoerper, RGD1562694 antikoerper, diphthamide biosynthesis 1 antikoerper, diphthamide biosynthesis protein 1 antikoerper, diphthamide biosynthesis 1 L homeolog antikoerper, 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 antikoerper, DPH1 antikoerper, NCU08503 antikoerper, ATEG_01183 antikoerper, LELG_00973 antikoerper, HCAG_03806 antikoerper, AOR_1_728014 antikoerper, PTRG_05729 antikoerper, CTRG_01524 antikoerper, UREG_06411 antikoerper, BDBG_05574 antikoerper, MCYG_04396 antikoerper, PITG_12187 antikoerper, MGYG_02224 antikoerper, LOC100284663 antikoerper, dph1.L antikoerper, dph1 antikoerper, Dph1 antikoerper, dph-1 antikoerper

Hintergrund: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Molekulargewicht: 49 kDa (MW of target protein)