DYNC1I1 Antikörper (N-Term)
-
- Target Alle DYNC1I1 Antikörper anzeigen
- DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DYNC1I1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DYNC1 I1 antibody was raised against the N terminal of DYNC1 1
- Aufreinigung
- Affinity purified
- Immunogen
- DYNC1 I1 antibody was raised using the N terminal of DYNC1 1 corresponding to a region with amino acids IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP
- Top Product
- Discover our top product DYNC1I1 Primärantikörper
-
anti-Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) (AA 1-220) antibody
DYNC1I1 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) antibodyDYNC1I1 Reaktivität: Human, Ratte, Maus IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) (AA 1-100) antibodyDYNC1I1 Reaktivität: Human, Ratte WB, ELISA, FACS, IF (cc), IF (p), IHC (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) (AA 1-100) antibody (FITC)DYNC1I1 Reaktivität: Human, Ratte WB, FACS, IF (cc), IF (p) Wirt: Kaninchen Polyclonal FITC
anti-Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) (AA 110-159) antibodyDYNC1I1 Reaktivität: Human, Maus, Meerschweinchen, Pferd, Kaninchen, Hund, Affe, Fledermaus, Huhn, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) (AA 21-70) antibodyDYNC1I1 Reaktivität: Human, Maus, Meerschweinchen, Pferd, Kaninchen, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DYNC1I1 Blocking Peptide, catalog no. 33R-4130, is also available for use as a blocking control in assays to test for specificity of this DYNC1I1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))
- Andere Bezeichnung
- DYNC1I1 (DYNC1I1 Produkte)
- Synonyme
- Dnci1 antikoerper, Dncic1 antikoerper, DH IC-1 antikoerper, DHIC-1 antikoerper, DIC antikoerper, IC74 antikoerper, DNCI1 antikoerper, DNCIC1 antikoerper, dynein cytoplasmic 1 intermediate chain 1 antikoerper, Dync1i1 antikoerper, DYNC1I1 antikoerper
- Hintergrund
- DYNC1I1 belongs to the dynein intermediate chain family. It contains 7 WD repeats. The intermediate chains seem to help dynein bind to dynactin 150 kDa component. DYNC1I1 may play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.
- Molekulargewicht
- 73 kDa (MW of target protein)
-
