DYNC1I1 Antikörper (N-Term)
-
- Target Alle DYNC1I1 Antikörper anzeigen
- DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DYNC1I1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DYNC1 I1 antibody was raised against the N terminal of DYNC1 1
- Aufreinigung
- Affinity purified
- Immunogen
- DYNC1 I1 antibody was raised using the N terminal of DYNC1 1 corresponding to a region with amino acids GSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFL
- Top Product
- Discover our top product DYNC1I1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DYNC1I1 Blocking Peptide, catalog no. 33R-3577, is also available for use as a blocking control in assays to test for specificity of this DYNC1I1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))
- Andere Bezeichnung
- DYNC1I1 (DYNC1I1 Produkte)
- Synonyme
- Dnci1 antikoerper, Dncic1 antikoerper, DH IC-1 antikoerper, DHIC-1 antikoerper, DIC antikoerper, IC74 antikoerper, DNCI1 antikoerper, DNCIC1 antikoerper, dynein cytoplasmic 1 intermediate chain 1 antikoerper, Dync1i1 antikoerper, DYNC1I1 antikoerper
- Hintergrund
- The aldehyde dehydrogenases are a family of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3B1 is highly expressed in kidney and lung.
- Molekulargewicht
- 73 kDa (MW of target protein)
-