LRRC42 Antikörper (N-Term)

Produktnummer ABIN632704

Produktdetails anti-LRRC42 Antikörper

Target: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC42 antibody was raised against the N terminal of LRRC42

Aufreinigung: Affinity purified

Immunogen: LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC42 Blocking Peptide, catalog no. 33R-5043, is also available for use as a blocking control in assays to test for specificity of this LRRC42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC42

Target: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Andere Bezeichnung: LRRC42 (LRRC42 Produkte)

Synonyme: dJ167A19.4 antikoerper, A930011F22Rik antikoerper, AA536996 antikoerper, RGD1308919 antikoerper, wu:fe17g08 antikoerper, zgc:56446 antikoerper, zgc:77847 antikoerper, leucine rich repeat containing 42 antikoerper, leucine rich repeat containing 42 L homeolog antikoerper, LRRC42 antikoerper, Lrrc42 antikoerper, lrrc42.L antikoerper, lrrc42 antikoerper

Hintergrund: The function of LRRC42 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 48 kDa (MW of target protein)