C8orf34 Antikörper (N-Term)

Produktnummer ABIN632705

Produktdetails anti-C8orf34 Antikörper

Target: C8orf34 (Chromosome 8 Open Reading Frame 34 (C8orf34))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C8orf34 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C8 ORF34 antibody was raised against the N terminal Of C8 rf34

Aufreinigung: Affinity purified

Immunogen: C8 ORF34 antibody was raised using the N terminal Of C8 rf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C8ORF34 Blocking Peptide, catalog no. 33R-6548, is also available for use as a blocking control in assays to test for specificity of this C8ORF34 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF34 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C8orf34

Target: C8orf34 (Chromosome 8 Open Reading Frame 34 (C8orf34))

Andere Bezeichnung: C8ORF34 (C8orf34 Produkte)

Synonyme: C2H8orf34 antikoerper, VEST-1 antikoerper, VEST1 antikoerper, C8orf34 antikoerper, chromosome 2 open reading frame, human C8orf34 antikoerper, chromosome 8 open reading frame 34 antikoerper, chromosome 29 C8orf34 homolog antikoerper, C2H8ORF34 antikoerper, C8orf34 antikoerper, C29H8orf34 antikoerper

Hintergrund: The function of C8orf34 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 47 kDa (MW of target protein)