C20orf160 Antikörper (N-Term)

Produktnummer ABIN632706

Produktdetails anti-C20orf160 Antikörper

Target: C20orf160 (Chromosome 20 Open Reading Frame 160 (C20orf160))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C20orf160 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C20 ORF160 antibody was raised against the N terminal Of C20 rf160

Aufreinigung: Affinity purified

Immunogen: C20 ORF160 antibody was raised using the N terminal Of C20 rf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C20ORF160 Blocking Peptide, catalog no. 33R-5492, is also available for use as a blocking control in assays to test for specificity of this C20ORF160 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF160 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C20orf160

Target: C20orf160 (Chromosome 20 Open Reading Frame 160 (C20orf160))

Andere Bezeichnung: C20ORF160 (C20orf160 Produkte)

Hintergrund: The specific function of C20orf160 is not yet known.

Molekulargewicht: 47 kDa (MW of target protein)