C20orf141 Antikörper (Middle Region)

Produktnummer ABIN632707

Produktdetails anti-C20orf141 Antikörper

Target: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C20orf141 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C20 ORF141 antibody was raised against the middle region of C20 rf141

Aufreinigung: Affinity purified

Immunogen: C20 ORF141 antibody was raised using the middle region of C20 rf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C20ORF141 Blocking Peptide, catalog no. 33R-3864, is also available for use as a blocking control in assays to test for specificity of this C20ORF141 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF141 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C20orf141

Target: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Andere Bezeichnung: C20ORF141 (C20orf141 Produkte)

Synonyme: dJ860F19.4 antikoerper, chromosome 20 open reading frame 141 antikoerper, chromosome 10 C20orf141 homolog antikoerper, C20orf141 antikoerper, C10H20orf141 antikoerper

Hintergrund: The function of C20orf141 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 17 kDa (MW of target protein)