Sialidase 4 Antikörper (N-Term)
-
- Target Alle Sialidase 4 (NEU4) Antikörper anzeigen
- Sialidase 4 (NEU4)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Sialidase 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NEU4 antibody was raised against the N terminal of NEU4
- Aufreinigung
- Affinity purified
- Immunogen
- NEU4 antibody was raised using the N terminal of NEU4 corresponding to a region with amino acids TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE
- Top Product
- Discover our top product NEU4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NEU4 Blocking Peptide, catalog no. 33R-9097, is also available for use as a blocking control in assays to test for specificity of this NEU4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Sialidase 4 (NEU4)
- Andere Bezeichnung
- NEU4 (NEU4 Produkte)
- Hintergrund
- NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.
- Molekulargewicht
- 53 kDa (MW of target protein)
-