DUSP19 Antikörper (C-Term)
-
- Target Alle DUSP19 Antikörper anzeigen
- DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DUSP19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DUSP19 antibody was raised against the C terminal of DUSP19
- Aufreinigung
- Affinity purified
- Immunogen
- DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
- Top Product
- Discover our top product DUSP19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DUSP19 Blocking Peptide, catalog no. 33R-8399, is also available for use as a blocking control in assays to test for specificity of this DUSP19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))
- Andere Bezeichnung
- DUSP19 (DUSP19 Produkte)
- Hintergrund
- DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.
- Molekulargewicht
- 24 kDa (MW of target protein)
-