ACOT12 Antikörper (Middle Region)
-
- Target Alle ACOT12 Antikörper anzeigen
- ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACOT12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACOT12 antibody was raised against the middle region of ACOT12
- Aufreinigung
- Affinity purified
- Immunogen
- ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV
- Top Product
- Discover our top product ACOT12 Primärantikörper
-
anti-Acyl-CoA Thioesterase 12 (ACOT12) antibody
ACOT12 Reaktivität: Human, Affe WB, IHC, FACS, IHC (p) Wirt: Maus Monoclonal 1B9 unconjugated
anti-Acyl-CoA Thioesterase 12 (ACOT12) antibodyACOT12 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 12 (ACOT12) (AA 216-265) antibodyACOT12 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Pferd, Affe, Fledermaus, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 12 (ACOT12) (AA 290-537) antibodyACOT12 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 12 (ACOT12) (AA 281-330) antibodyACOT12 Reaktivität: Human, Maus, Ratte IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 12 (ACOT12) (Middle Region) antibodyACOT12 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Pferd, Zebrafisch (Danio rerio), Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACOT12 Blocking Peptide, catalog no. 33R-8317, is also available for use as a blocking control in assays to test for specificity of this ACOT12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))
- Andere Bezeichnung
- ACOT12 (ACOT12 Produkte)
- Synonyme
- MGC189641 antikoerper, CACH-1 antikoerper, Cach antikoerper, STARD15 antikoerper, THEAL antikoerper, 1300004O04Rik antikoerper, 4930449F15Rik antikoerper, AV027244 antikoerper, mCACH-1 antikoerper, rACH antikoerper, acyl-CoA thioesterase 12 antikoerper, acyl-CoA thioesterase 12 L homeolog antikoerper, ACOT12 antikoerper, acot12 antikoerper, acot12.L antikoerper, Acot12 antikoerper
- Hintergrund
- ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.
- Molekulargewicht
- 62 kDa (MW of target protein)
-
