KIAA1958 Antikörper (C-Term)

Produktnummer ABIN632714

Produktdetails anti-KIAA1958 Antikörper

Target: KIAA1958

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIAA1958 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA1958 antibody was raised against the C terminal of KIAA1958

Aufreinigung: Affinity purified

Immunogen: KIAA1958 antibody was raised using the C terminal of KIAA1958 corresponding to a region with amino acids SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA1958 Blocking Peptide, catalog no. 33R-8678, is also available for use as a blocking control in assays to test for specificity of this KIAA1958 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1958 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIAA1958

Target: KIAA1958

Andere Bezeichnung: KIAA1958 (KIAA1958 Produkte)

Synonyme: KIAA1958 antikoerper, KIAA1958 ortholog antikoerper, KIAA1958 antikoerper, kiaa1958 antikoerper

Hintergrund: The function of KIAA1958 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 62 kDa (MW of target protein)