FAM83F Antikörper (Middle Region)
-
- Target Alle FAM83F Produkte
- FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM83F Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM83 F antibody was raised against the middle region of FAM83
- Aufreinigung
- Affinity purified
- Immunogen
- FAM83 F antibody was raised using the middle region of FAM83 corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM83F Blocking Peptide, catalog no. 33R-3043, is also available for use as a blocking control in assays to test for specificity of this FAM83F antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))
- Andere Bezeichnung
- FAM83F (FAM83F Produkte)
- Synonyme
- AW544981 antikoerper, RGD1562089 antikoerper, zgc:92122 antikoerper, family with sequence similarity 83, member F antikoerper, family with sequence similarity 83 member F antikoerper, family with sequence similarity 83, member Fb antikoerper, Fam83f antikoerper, FAM83F antikoerper, fam83fb antikoerper
- Hintergrund
- The function of FAM83F protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 55 kDa (MW of target protein)
-