C11ORF74 Antikörper (Middle Region)
-
- Target Alle C11ORF74 Antikörper anzeigen
- C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C11ORF74 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C11 ORF74 antibody was raised against the middle region of C11 rf74
- Aufreinigung
- Affinity purified
- Immunogen
- C11 ORF74 antibody was raised using the middle region of C11 rf74 corresponding to a region with amino acids VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
- Top Product
- Discover our top product C11ORF74 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C11ORF74 Blocking Peptide, catalog no. 33R-9749, is also available for use as a blocking control in assays to test for specificity of this C11ORF74 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF74 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))
- Andere Bezeichnung
- C11ORF74 (C11ORF74 Produkte)
- Synonyme
- HEPIS antikoerper, chromosome 11 open reading frame 74 antikoerper, chromosome 5 C11orf74 homolog antikoerper, C11orf74 antikoerper, C5H11orf74 antikoerper, c11orf74 antikoerper
- Hintergrund
- The function of C11orf74 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 25 kDa (MW of target protein)
-