DYDC1 Antikörper (Middle Region)

Produktnummer ABIN632723

Produktdetails anti-DYDC1 Antikörper

Target: DYDC1 (DPY30 Domain Containing 1 (DYDC1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DYDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DYDC1 antibody was raised against the middle region of DYDC1

Aufreinigung: Affinity purified

Immunogen: DYDC1 antibody was raised using the middle region of DYDC1 corresponding to a region with amino acids EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYDC1 Blocking Peptide, catalog no. 33R-2315, is also available for use as a blocking control in assays to test for specificity of this DYDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DYDC1

Target: DYDC1 (DPY30 Domain Containing 1 (DYDC1))

Andere Bezeichnung: DYDC1 (DYDC1 Produkte)

Synonyme: DPY30D1 antikoerper, 1700029M23Rik antikoerper, DPY30 domain containing 1 antikoerper, DPY30 domain containing 1 L homeolog antikoerper, DYDC1 antikoerper, dydc1.L antikoerper, Dydc1 antikoerper

Hintergrund: DYDC1 plays a crucial role during acrosome biogenesis.

Molekulargewicht: 21 kDa (MW of target protein)