PACRGL Antikörper (Middle Region)

Produktnummer ABIN632727

Produktdetails anti-PACRGL Antikörper

Target: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PACRGL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C4 ORF28 antibody was raised against the middle region of C4 rf28

Aufreinigung: Affinity purified

Immunogen: C4 ORF28 antibody was raised using the middle region of C4 rf28 corresponding to a region with amino acids PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C4ORF28 Blocking Peptide, catalog no. 33R-7248, is also available for use as a blocking control in assays to test for specificity of this C4ORF28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PACRGL

Target: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Andere Bezeichnung: C4ORF28 (PACRGL Produkte)

Synonyme: RGD1311045 antikoerper, C4orf28 antikoerper, 4933428G09Rik antikoerper, parkin coregulated like antikoerper, parkin coregulated like L homeolog antikoerper, PARK2 co-regulated-like antikoerper, Pacrgl antikoerper, PACRGL antikoerper, pacrgl antikoerper, pacrgl.L antikoerper

Hintergrund: The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 24 kDa (MW of target protein)