C16ORF46 Antikörper (N-Term)

Produktnummer ABIN632731

Produktdetails anti-C16ORF46 Antikörper

Target: C16ORF46 (Chromosome 16 Open Reading Frame 46 (C16ORF46))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C16ORF46 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C16 ORF46 antibody was raised against the N terminal Of C16 rf46

Aufreinigung: Affinity purified

Immunogen: C16 ORF46 antibody was raised using the N terminal Of C16 rf46 corresponding to a region with amino acids LSHWSLQTKPPTEGGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C16ORF46 Blocking Peptide, catalog no. 33R-5431, is also available for use as a blocking control in assays to test for specificity of this C16ORF46 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C16ORF46

Target: C16ORF46 (Chromosome 16 Open Reading Frame 46 (C16ORF46))

Andere Bezeichnung: C16ORF46 (C16ORF46 Produkte)

Synonyme: chromosome 16 open reading frame 46 antikoerper, chromosome 18 open reading frame, human C16orf46 antikoerper, chromosome 16 C16orf46 homolog antikoerper, C16orf46 antikoerper, C18H16orf46 antikoerper, C16H16orf46 antikoerper

Hintergrund: The function of C16orf46 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 43 kDa (MW of target protein)