LSM12B Antikörper

Produktnummer ABIN632732

Produktdetails anti-LSM12B Antikörper

Target: LSM12B (LSM12 Homolog B (LSM12B))

Reaktivität: Maus, Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSM12B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSM12 Blocking Peptide, catalog no. 33R-7290, is also available for use as a blocking control in assays to test for specificity of this LSM12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSM12B

Target: LSM12B (LSM12 Homolog B (LSM12B))

Andere Bezeichnung: LSM12 (LSM12B Produkte)

Hintergrund: LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.

Molekulargewicht: 22 kDa (MW of target protein)