KRT222 Antikörper (N-Term)
-
- Target Alle KRT222 Produkte
- KRT222 (Keratin 222 (KRT222))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Maus, Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KRT222 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cytokeratin 222 Pseudogene antibody was raised against the N terminal of KRT222 P
- Aufreinigung
- Affinity purified
- Immunogen
- Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222 P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 222 Pseudogene Blocking Peptide, catalog no. 33R-2575, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 222 Pseudogene antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT220 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRT222 (Keratin 222 (KRT222))
- Abstract
- KRT222 Produkte
- Hintergrund
- KRT222P belongs to the intermediate filament family. The exact function of KRT222P is not known.
- Molekulargewicht
- 34 kDa (MW of target protein)
-