FAM161B Antikörper (Middle Region)

Produktnummer ABIN632736

Produktdetails anti-FAM161B Antikörper

Target: FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM161B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF44 antibody was raised against the middle region of C14 rf44

Aufreinigung: Affinity purified

Immunogen: C14 ORF44 antibody was raised using the middle region of C14 rf44 corresponding to a region with amino acids AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF44 Blocking Peptide, catalog no. 33R-1385, is also available for use as a blocking control in assays to test for specificity of this C14ORF44 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF44 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM161B

Target: FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))

Andere Bezeichnung: C14ORF44 (FAM161B Produkte)

Synonyme: C14orf44 antikoerper, c14_5547 antikoerper, 9330169D17 antikoerper, 9830169C18Rik antikoerper, RGD1309058 antikoerper, family with sequence similarity 161 member B antikoerper, family with sequence similarity 161, member B antikoerper, FAM161B antikoerper, Fam161b antikoerper

Hintergrund: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 74 kDa (MW of target protein)