FAM81A Antikörper (N-Term)

Produktnummer ABIN632737

Produktdetails anti-FAM81A Antikörper

Target: FAM81A (Family with Sequence Similarity 81, Member A (FAM81A))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM81A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM81 A antibody was raised against the N terminal of FAM81

Aufreinigung: Affinity purified

Immunogen: FAM81 A antibody was raised using the N terminal of FAM81 corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM81A Blocking Peptide, catalog no. 33R-3209, is also available for use as a blocking control in assays to test for specificity of this FAM81A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM81A

Target: FAM81A (Family with Sequence Similarity 81, Member A (FAM81A))

Andere Bezeichnung: FAM81A (FAM81A Produkte)

Synonyme: 6430514L14Rik antikoerper, RGD1311958 antikoerper, family with sequence similarity 81, member A antikoerper, family with sequence similarity 81 member A antikoerper, Fam81a antikoerper, FAM81A antikoerper

Hintergrund: The function of FAM81 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)