C4ORF23 Antikörper (N-Term)

Produktnummer ABIN632740

Produktdetails anti-C4ORF23 Antikörper

Target: C4ORF23 (METTL19) (Methyltransferase Like 19 (METTL19))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C4ORF23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C4 ORF23 antibody was raised against the N terminal Of C4 rf23

Aufreinigung: Affinity purified

Immunogen: C4 ORF23 antibody was raised using the N terminal Of C4 rf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C4ORF23 Blocking Peptide, catalog no. 33R-5486, is also available for use as a blocking control in assays to test for specificity of this C4ORF23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C4ORF23

Target: C4ORF23 (METTL19) (Methyltransferase Like 19 (METTL19))

Andere Bezeichnung: C4ORF23 (METTL19 Produkte)

Synonyme: C4orf23 antikoerper, 2310079F23Rik antikoerper, Mettl19 antikoerper, c4orf23 antikoerper, mettl19 antikoerper, METTL19 antikoerper, TRM44 antikoerper, tRNA methyltransferase 44 homolog (S. cerevisiae) antikoerper, tRNA methyltransferase 44 antikoerper, tRNA methyltransferase 44 homolog L homeolog antikoerper, tRNA methyltransferase 44 homolog antikoerper, TRMT44 antikoerper, Trmt44 antikoerper, trmt44.L antikoerper

Hintergrund: The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)