NANP Antikörper (Middle Region)
-
- Target Alle NANP Antikörper anzeigen
- NANP (N-Acetylneuraminic Acid Phosphatase (NANP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NANP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NANP antibody was raised against the middle region of NANP
- Aufreinigung
- Affinity purified
- Immunogen
- NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS
- Top Product
- Discover our top product NANP Primärantikörper
-
anti-N-Acetylneuraminic Acid Phosphatase (NANP) antibody
NANP Reaktivität: Human, Maus, Ratte ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) (AA 1-248) antibodyNANP Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) (Internal Region) antibodyNANP Reaktivität: Human, Maus, Ratte, Kaninchen, Affe, Hamster IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) (Internal Region) antibodyNANP Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Hamster IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) (N-Term) antibodyNANP Reaktivität: Human, Maus, Ratte, Affe, Rind (Kuh), Fledermaus IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) antibodyNANP Reaktivität: Human WB, IHC, IHC (p) Wirt: Maus Monoclonal 3C1 unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) antibodyNANP Reaktivität: Human WB, IHC, IHC (p) Wirt: Maus Monoclonal 4F5 unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) (AA 1-248) antibodyNANP Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) (AA 1-248) antibodyNANP Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-N-Acetylneuraminic Acid Phosphatase (NANP) (AA 179-228) antibodyNANP Reaktivität: Human, Maus, Ratte, Kaninchen, Affe, Hund, Rind (Kuh), Hamster, Meerschweinchen, Schwein, Zebrafisch (Danio rerio), Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NANP Blocking Peptide, catalog no. 33R-9755, is also available for use as a blocking control in assays to test for specificity of this NANP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NANP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium Azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NANP (N-Acetylneuraminic Acid Phosphatase (NANP))
- Andere Bezeichnung
- NANP (NANP Produkte)
- Synonyme
- rgd1306009 antikoerper, C20orf147 antikoerper, HDHD4 antikoerper, dJ694B14.3 antikoerper, 1600031M04Rik antikoerper, Hdhd4 antikoerper, RGD1306009 antikoerper, zgc:111947 antikoerper, N-acylneuraminate-9-phosphatase antikoerper, N-acetylneuraminic acid phosphatase antikoerper, N-acetylneuraminic acid phosphatase L homeolog antikoerper, nanp antikoerper, NANP antikoerper, Nanp antikoerper, nanp.L antikoerper
- Hintergrund
- The function of NANP protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 28 kDa (MW of target protein)
-
