RWDD4A Antikörper (N-Term)
-
- Target Alle RWDD4A (RWDD4) Antikörper anzeigen
- RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RWDD4A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RWDD4 A antibody was raised against the N terminal of RWDD4
- Aufreinigung
- Affinity purified
- Immunogen
- RWDD4 A antibody was raised using the N terminal of RWDD4 corresponding to a region with amino acids MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEIS
- Top Product
- Discover our top product RWDD4 Primärantikörper
-
anti-RWD Domain Containing 4 (RWDD4) (C-Term) antibody
RWDD4 Reaktivität: Human, Maus, Ratte, Schwein, Kaninchen, Rind (Kuh), Hund, Pferd, Affe, Fledermaus, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-RWD Domain Containing 4 (RWDD4) (N-Term) antibodyRWDD4 Reaktivität: Human, Maus, Ratte, Schwein, Kaninchen, Rind (Kuh), Hund, Pferd, Zebrafisch (Danio rerio), Affe, Fledermaus, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-RWD Domain Containing 4 (RWDD4) (Middle Region) antibodyRWDD4 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-RWD Domain Containing 4 (RWDD4) (N-Term) antibodyRWDD4 Reaktivität: Human, Maus, Ratte, Schwein, Kaninchen, Rind (Kuh), Hund, Pferd, Zebrafisch (Danio rerio), Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RWDD4A Blocking Peptide, catalog no. 33R-6396, is also available for use as a blocking control in assays to test for specificity of this RWDD4A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RWDD4A (RWDD4) (RWD Domain Containing 4 (RWDD4))
- Andere Bezeichnung
- RWDD4A (RWDD4 Produkte)
- Synonyme
- BC016198 antikoerper, Gm1942 antikoerper, Rwdd4 antikoerper, FAM28A antikoerper, RWDD4A antikoerper, fam28a antikoerper, rwdd4a antikoerper, Rwdd4a antikoerper, si:ch211-192e21.1 antikoerper, zgc:103545 antikoerper, RWD domain containing 4A antikoerper, RWD domain containing 4 antikoerper, RWD domain containing 4 L homeolog antikoerper, Rwdd4a antikoerper, RWDD4 antikoerper, rwdd4.L antikoerper, Rwdd4 antikoerper, rwdd antikoerper
- Hintergrund
- The function of RWDD4 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 21 kDa (MW of target protein)
-
