PDIK1L Antikörper (Middle Region)
-
- Target Alle PDIK1L Antikörper anzeigen
- PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDIK1L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDIK1 L antibody was raised against the middle region of PDIK1
- Aufreinigung
- Affinity purified
- Immunogen
- PDIK1 L antibody was raised using the middle region of PDIK1 corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH
- Top Product
- Discover our top product PDIK1L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDIK1L Blocking Peptide, catalog no. 33R-2870, is also available for use as a blocking control in assays to test for specificity of this PDIK1L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIK0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))
- Andere Bezeichnung
- PDIK1L (PDIK1L Produkte)
- Synonyme
- CLIK1L antikoerper, STK35L2 antikoerper, BC027088 antikoerper, stk35l2 antikoerper, RGD1307476 antikoerper, Stk35l2 antikoerper, pdik1-a antikoerper, pdik1l antikoerper, pdik1-b antikoerper, MGC81117 antikoerper, wu:fc95a02 antikoerper, zgc:123209 antikoerper, LOC100224737 antikoerper, PDLIM1 interacting kinase 1 like antikoerper, PDLIM1 interacting kinase 1 like S homeolog antikoerper, PDLIM1 interacting kinase 1 like L homeolog antikoerper, PDIK1L antikoerper, Pdik1l antikoerper, pdik1l.S antikoerper, pdik1l.L antikoerper, pdik1l antikoerper
- Hintergrund
- The specific function of PDIK1L is not yet known.
- Molekulargewicht
- 38 kDa (MW of target protein)
-