C22orf25 Antikörper (N-Term)
-
- Target Alle C22orf25 Produkte
- C22orf25 (Chromosome 22 Open Reading Frame 25 (C22orf25))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C22orf25 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C22 ORF25 antibody was raised against the N terminal Of C22 rf25
- Aufreinigung
- Affinity purified
- Immunogen
- C22 ORF25 antibody was raised using the N terminal Of C22 rf25 corresponding to a region with amino acids MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C22ORF25 Blocking Peptide, catalog no. 33R-5813, is also available for use as a blocking control in assays to test for specificity of this C22ORF25 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF25 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C22orf25 (Chromosome 22 Open Reading Frame 25 (C22orf25))
- Andere Bezeichnung
- C22ORF25 (C22orf25 Produkte)
- Synonyme
- c22orf25 antikoerper, MGC88919 antikoerper, C22orf25 antikoerper, TANGO2 antikoerper, C17H22orf25 antikoerper, transport and golgi organization 2 homolog L homeolog antikoerper, transport and golgi organization 2 homolog antikoerper, transport and golgi organization 2 homolog (Drosophila) antikoerper, tango2.L antikoerper, tango2 antikoerper, TANGO2 antikoerper
- Hintergrund
- The function of C22orf25 has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 31 kDa (MW of target protein)
-