IQCK Antikörper (Middle Region)

Produktnummer ABIN632754

Produktdetails anti-IQCK Antikörper

Target: IQCK (IQ Motif Containing K (IQCK))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IQCK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IQCK antibody was raised against the middle region of IQCK

Aufreinigung: Affinity purified

Immunogen: IQCK antibody was raised using the middle region of IQCK corresponding to a region with amino acids GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IQCK Blocking Peptide, catalog no. 33R-3433, is also available for use as a blocking control in assays to test for specificity of this IQCK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IQCK

Target: IQCK (IQ Motif Containing K (IQCK))

Andere Bezeichnung: IQCK (IQCK Produkte)

Synonyme: A230094G09Rik antikoerper, IQ motif containing K antikoerper, IQCK antikoerper, Iqck antikoerper

Hintergrund: The function of IQC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 33 kDa (MW of target protein)