TBC1D21 Antikörper (N-Term)

Produktnummer ABIN632761

Produktdetails anti-TBC1D21 Antikörper

Target: TBC1D21 (TBC1 Domain Family, Member 21 (TBC1D21))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TBC1 D21 antibody was raised against the N terminal of TBC1 21

Aufreinigung: Affinity purified

Immunogen: TBC1 D21 antibody was raised using the N terminal of TBC1 21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D21 Blocking Peptide, catalog no. 33R-6568, is also available for use as a blocking control in assays to test for specificity of this TBC1D21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D21

Target: TBC1D21 (TBC1 Domain Family, Member 21 (TBC1D21))

Andere Bezeichnung: TBC1D21 (TBC1D21 Produkte)

Synonyme: 1700095K08Rik antikoerper, MgcRabGAP antikoerper, RGD1310243 antikoerper, TBC1 domain family, member 21 antikoerper, TBC1 domain family member 21 antikoerper, Tbc1d21 antikoerper, TBC1D21 antikoerper

Hintergrund: TBC1D21 may act as a GTPase-activating protein for Rab family proteins.

Molekulargewicht: 39 kDa (MW of target protein)