FAM71A Antikörper (C-Term)
-
- Target Alle FAM71A Produkte
- FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM71A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM71 A antibody was raised against the C terminal of FAM71
- Aufreinigung
- Affinity purified
- Immunogen
- FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM71A Blocking Peptide, catalog no. 33R-2019, is also available for use as a blocking control in assays to test for specificity of this FAM71A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))
- Andere Bezeichnung
- FAM71A (FAM71A Produkte)
- Hintergrund
- FAM71A belongs to the FAM71 family. The exact function of C15orf27 remains unknown.
- Molekulargewicht
- 63 kDa (MW of target protein)
-