C5orf35 Antikörper (N-Term)

Produktnummer ABIN632765

Produktdetails anti-C5orf35 Antikörper

Target: C5orf35 (Chromosome 5 Open Reading Frame 35 (C5orf35))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C5orf35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C5 ORF35 antibody was raised against the N terminal Of C5 rf35

Aufreinigung: Affinity purified

Immunogen: C5 ORF35 antibody was raised using the N terminal Of C5 rf35 corresponding to a region with amino acids QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C5ORF35 Blocking Peptide, catalog no. 33R-7722, is also available for use as a blocking control in assays to test for specificity of this C5ORF35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C5orf35

Target: C5orf35 (Chromosome 5 Open Reading Frame 35 (C5orf35))

Andere Bezeichnung: C5ORF35 (C5orf35 Produkte)

Synonyme: DKFZp468C1120 antikoerper, C5orf35 antikoerper, SET domain containing 9 antikoerper, SETD9 antikoerper, setd9 antikoerper

Hintergrund: The function of C5orf35 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 34 kDa (MW of target protein)