C19orf21 Antikörper (C-Term)
-
- Target Alle C19orf21 (MISP) Produkte
- C19orf21 (MISP) (Mitotic Spindle Positioning (MISP))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C19orf21 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C19 ORF21 antibody was raised against the C terminal Of C19 rf21
- Aufreinigung
- Affinity purified
- Immunogen
- C19 ORF21 antibody was raised using the C terminal Of C19 rf21 corresponding to a region with amino acids RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C19ORF21 Blocking Peptide, catalog no. 33R-8150, is also available for use as a blocking control in assays to test for specificity of this C19ORF21 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C19orf21 (MISP) (Mitotic Spindle Positioning (MISP))
- Andere Bezeichnung
- C19ORF21 (MISP Produkte)
- Synonyme
- C19orf21 antikoerper, 9130017N09Rik antikoerper, mitotic spindle positioning antikoerper, MISP antikoerper, Misp antikoerper
- Hintergrund
- The function of C19orf21 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 75 kDa (MW of target protein)
-