NR2C2AP Antikörper (N-Term)

Produktnummer ABIN632770

Produktdetails anti-NR2C2AP Antikörper

Target: NR2C2AP (Nuclear Receptor 2C2-Associated Protein (NR2C2AP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR2C2AP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRA16 antibody was raised against the N terminal Of Tra16

Aufreinigung: Affinity purified

Immunogen: TRA16 antibody was raised using the N terminal Of Tra16 corresponding to a region with amino acids THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRA16 Blocking Peptide, catalog no. 33R-9109, is also available for use as a blocking control in assays to test for specificity of this TRA16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRA16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR2C2AP

Target: NR2C2AP (Nuclear Receptor 2C2-Associated Protein (NR2C2AP))

Andere Bezeichnung: TRA16 (NR2C2AP Produkte)

Synonyme: tra16 antikoerper, NR2C2AP antikoerper, TRA16 antikoerper, 2310073E15Rik antikoerper, si:ch211-125m10.4 antikoerper, zgc:136330 antikoerper, nuclear receptor 2C2-associated protein antikoerper, nuclear receptor 2C2 associated protein antikoerper, nuclear receptor 2C2-associated protein S homeolog antikoerper, nr2c2ap antikoerper, NR2C2AP antikoerper, Nr2c2ap antikoerper, nr2c2ap.S antikoerper

Hintergrund: TRA16 may act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway