OLFML2A Antikörper (N-Term)

Produktnummer ABIN632773

Produktdetails anti-OLFML2A Antikörper

Target: OLFML2A (Olfactomedin-Like 2A (OLFML2A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OLFML2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OLFML2 A antibody was raised against the N terminal of OLFML2

Aufreinigung: Affinity purified

Immunogen: OLFML2 A antibody was raised using the N terminal of OLFML2 corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OLFML2A Blocking Peptide, catalog no. 33R-2311, is also available for use as a blocking control in assays to test for specificity of this OLFML2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OLFML2A

Target: OLFML2A (Olfactomedin-Like 2A (OLFML2A))

Andere Bezeichnung: OLFML2A (OLFML2A Produkte)

Synonyme: si:ch211-15b7.4 antikoerper, PRO34319 antikoerper, 4932431K08Rik antikoerper, mFLJ00237 antikoerper, olfactomedin-like 2A antikoerper, olfactomedin like 2A L homeolog antikoerper, olfactomedin like 2A antikoerper, olfml2a antikoerper, olfml2a.L antikoerper, OLFML2A antikoerper, Olfml2a antikoerper

Hintergrund: The exact function of OLFML2A is not known.

Molekulargewicht: 73 kDa (MW of target protein)