THAP5 Antikörper (Middle Region)

Produktnummer ABIN632774

Produktdetails anti-THAP5 Antikörper

Target: THAP5 (THAP Domain Containing 5 (THAP5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser THAP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: THAP5 antibody was raised against the middle region of THAP5

Aufreinigung: Affinity purified

Immunogen: THAP5 antibody was raised using the middle region of THAP5 corresponding to a region with amino acids TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THAP5 Blocking Peptide, catalog no. 33R-9320, is also available for use as a blocking control in assays to test for specificity of this THAP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THAP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu THAP5

Target: THAP5 (THAP Domain Containing 5 (THAP5))

Andere Bezeichnung: THAP5 (THAP5 Produkte)

Synonyme: THAP domain containing 5 antikoerper, THAP domain containing 5 S homeolog antikoerper, THAP5 antikoerper, thap5.S antikoerper

Hintergrund: THAP5 contains 1 THAP-type zinc finger. The exact function of THAP5 remains unknown.

Molekulargewicht: 44 kDa (MW of target protein)